SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004822 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000004822
Domain Number - Region: 18-130
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0994
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004822   Gene: ENSNLEG00000026846   Transcript: ENSNLET00000005072
Sequence length 151
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:19139727:19153800:1 gene:ENSNLEG00000026846 transcript:ENSNLET00000005072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNVQPKKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFIL
LYILRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCC
LADGALIYRKLLFNPSGPYQKKPVHEKKEVL
Download sequence
Identical sequences ENSNLEP00000004822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]