SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004863 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000004863
Domain Number - Region: 184-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00628
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004863   Gene: ENSNLEG00000003987   Transcript: ENSNLET00000005114
Sequence length 337
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:22100331:22118383:-1 gene:ENSNLEG00000003987 transcript:ENSNLET00000005114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPS
VALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAV
TCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMR
TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC
LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCVLSLGACARWWVTVCISTTFS
EGLGMSLPSLCLLTETAVLPNLSCIENGHFCKARWSK
Download sequence
Identical sequences G1QV93
ENSNLEP00000004863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]