SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005128 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005128
Domain Number 1 Region: 145-170,226-310
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000863
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005128   Gene: ENSNLEG00000004215   Transcript: ENSNLET00000005389
Sequence length 2075
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:16563562:16655610:-1 gene:ENSNLEG00000004215 transcript:ENSNLET00000005389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGERWRWRVRQARGRRASLHNLGPEERWHMAAERRCGSMRDLRAQVTSGLLPFPEVTLQA
LGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSITAERLSAYRFSGVSEQPPVVLA
VKEFSWQKRTGLLIGLEETEGSVLCLYDLGISKVVKAVVLPGRVTAIEPIINHGGASAST
QHLHPSLRWLFGVAAVVTDVGQILLIDLCLDDLSCNQNEVEASDLEVLTGIPAEVPHIRE
SVMREGRHLCFQLVSPTGTAVSTLSYINRTNQLAVGFSDGYLALWNMKSMKREYYIQLES
GQVPVYAVTFQEPENDPRNCCYLWAVQSTQDSEGDVLSLHLLQLAFGNRKCLASGQILYE
GLEYCEERYTLDLTGGMFPLRGQTSNTKLLGCQSIEKFRSHGDREEGVNEALSPDTSVSV
FTWQVNIYGQGKPSIYLGLFDINRWYHAQMPDSLRSGEYLHNCPYFALWSLESVVSRTSP
HGILDILVHERSLNRGVPPSYPPPEQFFNPSTYNFDATCLLNSGVVHLTCTGFQKETLTF
LKKSGPSLNEVIPDGYNRCLVAGLLSPRFVDVQPSSLSQEEQLEAILSAAIQTSSLGLLT
GYIKRWITEEQPNSATNLRFVLEWTWNKVVLTKEEFDRLCVPLFDGSCHFMDPQTIQSIQ
QCYLLLSNLNIVLSCFASEAREITERGLIDLSNKFVVSHLICQYAQVVLWFSHSGLLPEG
IDDSVQLSRLCYNYPVIQNYYTSRRQKFERLSRGKWNPDCLMIDGLVSQLGERIEKLWKR
DEGGTGKYPPASLHAVLDMYLLDGVTEAAKHSITIYLLLDIMYSFPNKTDTPIESFPTIF
AISWGQVKLIQGFWLIDHNDYESGLDLLFHPATAKPLSWQHSKIIQAFMSQGEHRQALRY
IQTMKPTVSSGSDVILHLTVLLFNRCMVEAWSFLRQHCNRLNIEELLKHMYEVCQEMGLM
EDLLKLPFTDTEQECLVKFLQSSASVQSHEFLLVHHLQRANYVPALKLNQTLKINVMNDR
DPRLRERSLARNSILDQYGKILPRVHRKLAIERAKPYHLSTSSVFRLVSRPKPLSAVPKQ
VVTGTVLTRSVFINNVLSKIGEVWASKEPINSTTPYNSSKIEEPSPIVYSLPAPELPEAF
FGTPISKASQKISRLLDLVVQPVPRPSQCSEFIQQSSMKSPLYLVSCSLPSSSQLKGSPQ
AISRASELHLLETPLVVKKAKSLAMSVTTSGFSEFTPQSILRSTLRSTPLASPSPSPGRS
PQRLKETRISFVEEDVNPKWIPGAADDSKLEVFTPKKYAVPAETEWLKSKDRTTSFFLNS
PEKEHQEMDVGSQSLKKLDVSKGNSSVSITSDETTLEYQDALSPEDLEETVFTASKPKSS
STALTTNVTEQTEKDGDKDVFASEVTPSDLQKQMGNLEDAETKDLLVAAEAFSELNHLSP
VQGTEASLCAPSVYAGKIFTQKSKVPVLDEGLTSVETYTSAIRANDNKSMADVLGDSGNS
SLTVSEGPVVSERRLNQEVALNLKEDHEVEVGVLKESVDLPEEKLPISDSPPDTQEIHVI
EQEKLDAQDSEEARNLSFNELYPSGTLKLQYNFDTIDQQFCDLADNKDTAECDIAEVDGE
LFVAQSNFTLILEGEEGEVEPGDFASSDVLPKAANTATEEKLVCSGENDNHGQVANLPSA
ITSDQKSQKVETLPYVPEPIKVAIAENLLDVIKDTRSKEITSDTMEQSIHETIPLVSQNI
MCPTKLVKSAFKTAQETSTMTVNVSQVDDVISSKTRTRGQRIQNVNVKSAQQEASADVAT
PKMPGQSVRKKTRKAKEISEASENTYSDVRGISQNPQIPQNSLTPRRGRRKKEVNQDILE
NTSSVEQELQITQQLPMKHIRRIRGREVSPSDVREDSSLESSQLTLEAEFGMSAIPRKRG
RPRKVNPSEDVGSKAVKEERSPKKKEAPGIKRRSTRNTPAKSENIDVGKPALGKSILVPN
EELLMVMRSKKKLTKKTESQSQKRSLHSVSEERTDEMTHKETNDQEERLLATASFSKSSR
STRTRSSKAILLPDLSEPNNEPLFSPASEVPRKAK
Download sequence
Identical sequences ENSNLEP00000005128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]