SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005300 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005300
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-22
Family Kringle modules 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005300   Gene: ENSNLEG00000004354   Transcript: ENSNLET00000005576
Sequence length 263
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:3588888:3600074:-1 gene:ENSNLEG00000004354 transcript:ENSNLET00000005576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLALAP
VLGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLSCPETTSQALPASTTEIEEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGSTPLMGQAGTPGA
Download sequence
Identical sequences G1QWH9
ENSNLEP00000005300 ENSNLEP00000005300 XP_003258150.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]