SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005408 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005408
Domain Number 1 Region: 5-234
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.34e-60
Family Adenylyltransferase 0.00000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005408   Gene: ENSNLEG00000004471   Transcript: ENSNLET00000005690
Sequence length 252
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:15833951:15897391:-1 gene:ENSNLEG00000004471 transcript:ENSNLET00000005690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRIPVVLLACGSFNPITNMHLRLFEVARDHLHQTGMYQVIQGIISPVNDNYGKKDLAA
SHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHRSELLRSPPQMEGPDHGKAL
SPTPAAAPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRAGHDPKGYISESP
ILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKDSAWK
GKSTQSAEGKTS
Download sequence
Identical sequences G1QWT7
ENSNLEP00000005408 XP_003265354.1.23891 ENSNLEP00000005408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]