SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005422 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005422
Domain Number 1 Region: 251-426,456-508
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.5e-41
Family Voltage-gated potassium channels 0.0031
Further Details:      
 
Domain Number 2 Region: 558-698
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-33
Family cAMP-binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-19
Family Flavin-binding PAS domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005422   Gene: ENSNLEG00000004473   Transcript: ENSNLET00000005705
Sequence length 987
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:7391548:7413015:-1 gene:ENSNLEG00000004473 transcript:ENSNLET00000005705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKRSSRSLSQRLLSQSFLGSESSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKCYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICIMLIGFVMFRVFRDTVSFCLPAWSSVARHHTQRRVFSLLYFYNLK
EKTAPPRPRPAGLGRPPVLQVLKGFPECLQADICLHLHRALLQHCPAFSGASKGCLRALA
VKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQP
GKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLRDAAGGLHSSPRQ
APGSQDHRGFFLSDNQSGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCASGHPDTAPPLS
ISDASGLWPELLQQMPPRRSPQSPQGDPDCWPLKLGSRLEQLQAQMNRLESRVSSDLSRI
LQLLQQPMSQSHASYILEAPASNDLALFPIASETTSPGPRLPQGFLPPAQTPSYGDLDDC
SPKHRNSSPRMPHLAVATDKILAPSSEQEQLEGLWPPLASPLHPPEVQGLICGPRFSSLP
EHLGSVPKQLDFQRHGSDPGFAGSWGH
Download sequence
Identical sequences ENSNLEP00000005422 ENSNLEP00000005422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]