SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005559 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005559
Domain Number 1 Region: 44-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.05e-65
Family Carbonic anhydrase 0.00000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005559   Gene: ENSNLEG00000004568   Transcript: ENSNLET00000005846
Sequence length 328
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:602451:610781:-1 gene:ENSNLEG00000004568 transcript:ENSNLET00000005846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNG
LAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGAPHGR
Download sequence
Identical sequences G1QX88 H2NZH6
9600.ENSPPYP00000011417 ENSPPYP00000011417 ENSNLEP00000005559 ENSPPYP00000011417 ENSNLEP00000005559 XP_003269790.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]