SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005585 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005585
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.89e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005585
Domain Number - Region: 208-322
Classification Level Classification E-value
Superfamily ALDH-like 0.0285
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005585   Gene: ENSNLEG00000004539   Transcript: ENSNLET00000005873
Sequence length 356
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:22894853:22898377:1 gene:ENSNLEG00000004539 transcript:ENSNLET00000005873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGPLLASGRAPRRSSSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVKMS
Download sequence
Identical sequences ENSNLEP00000005585 ENSNLEP00000005585 XP_003263421.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]