SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005619 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005619
Domain Number 1 Region: 373-506
Classification Level Classification E-value
Superfamily C-type lectin-like 2.58e-38
Family C-type lectin domain 0.00014
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 518-653
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-33
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 4 Region: 826-952
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-33
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 5 Region: 959-1110
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-32
Family C-type lectin domain 0.00048
Further Details:      
 
Domain Number 6 Region: 1254-1395
Classification Level Classification E-value
Superfamily C-type lectin-like 2.49e-27
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 7 Region: 41-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.38e-26
Family Cysteine rich domain 0.0047
Further Details:      
 
Domain Number 8 Region: 661-810
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-26
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 9 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 10 Region: 1125-1252
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-19
Family C-type lectin domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005619   Gene: ENSNLEG00000004611   Transcript: ENSNLET00000005910
Sequence length 1446
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:8295539:8480892:-1 gene:ENSNLEG00000004611 transcript:ENSNLET00000005910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGRPAPAPWPRHLLRCVLLLGGLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPIPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPFYQSYRSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQV
TYSEARRLCTDHSSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGSCPQGWASDPKLRYCYKVFSSERLQDKKSWVQAQGCQELGAQLLSLASYEEEH
FVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGLRFSYHNFDRSRHDDDD
IRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDLREPDDSPQGRREWLRFQEAEYKFFE
HHSTWAQAQRICTWFQAELTSVHSQAELDFLGHNLQKFSRAQEQHWWIGLHTSESDGRFR
WTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNITKETQP
PDLPTTALGGCPSGWIQFLTKCFQVQGQDPQSRVKWSEAQFSCEQQEAQLVTITNPLEQA
LISASLPNVTFDLWIGLHASQRDFQWVEQEPLRYSNWAPGEPSGPSPAPSGNKPTSCAVV
LHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLLQ
KPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLXXXXXXXXXSRRYSWVSE
EPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPPPPPRISYHGSC
PQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEMENVFVWEHLQSY
EGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWRP
GACSNITMGVVCKLPRGERQAGPRSASFHPVPLVLGWGWGLLHNCRGHSRWEGLNRPDCG
QLGPPG
Download sequence
Identical sequences ENSNLEP00000005619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]