SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005978 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005978
Domain Number 1 Region: 889-994
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000596
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 683-809
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000769
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 604-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000489
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 994-1122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000769
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 5 Region: 796-916
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000502
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 446-552,603-646
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000377
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005978
Domain Number - Region: 130-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.00272
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005978   Gene: ENSNLEG00000004881   Transcript: ENSNLET00000006289
Sequence length 1231
Comment pep:known_by_projection supercontig:Nleu1.0:GL397298.1:21185756:21277286:1 gene:ENSNLEG00000004881 transcript:ENSNLET00000006289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLWEPAGAWLALGLALALGPSVATAAPRQDCTGVECPPLENCIEEALEPGACCATCVQ
QGCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPN
CIEAVVVADSCPQCGQVGCVHAGRKYAAGHTVHLPPCRACHCPDAGGELICYQLPGCHGN
FSDAEEGDPERHYEDPYSYDQEVAEVEAAAALGGEVQAGAVQAGAGGPPAALGGGSQPLS
TIQAPPWPAALPRPTVAAALGPPAPVQAKARRVTEDSEEEEEEEEEREEMAVTEQLAAGG
HRGLDGLPTTAPAGPSLPIQEERAEAGARAEAGARPEENLIPDAQAMSRSTGPEGATPAP
GLGKAALVPTQAMPGSPRDPVKPSPSTILSIPLPDAAWIPPTREVPRKPQVLPHSHVEED
TDPNSVHSVPRSSPEGSTKDLIETCCAAGQQWAIDNDECLEIPESGMEGNVCRTAQRHCC
VSYLQEKSCMAGVLGAKEGETCGAEDNDTCGVSLYKQCCDCCGLGLRVRAEGQSCESNPN
LGYPCNHVMLSCCEGEEPLIVPEVRRPPEPAAAPRRVSEAEMAGREALSLGTEAELPNSL
PGDDQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPA
LKSEFSQVASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDQ
DECLMGAHDCSRRQFCVNTLGSFYCVNHTVLCADGYILNAHRKCVDINECVTDLHTCSRG
EHCVNTLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQAGFLCQNTKGSFYCQAR
QRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPLICARGYHASDDG
AKCVDVNECETGVHRCSEGQVCHNLPGSYRCDCKAGFQRDAFGRGCIDVNECWASPGRLC
QHTCENTLGSYRCSCASGFLLAADGKHCEDVNECEAQRCSQECANIYGSYQCYCRQGYQL
AEDGHTCTDIDECAQGAGILCTFRCLNVPGSYQCACPEQGYTMTANGRSCKDLDECALGT
HNCSEAETCHNIQGSFRCLRFECPPNYVQVSKTKCERTTCHDFLECQNSPARITHYQLNF
QTGLLVPAHIFRIGPAPAFTGDTIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRD
FALDVEMKLWRQGSVTTYMAKMHIFFTTFAL
Download sequence
Identical sequences ENSNLEP00000005978 ENSNLEP00000005978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]