SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006220 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006220
Domain Number 1 Region: 35-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-71
Family Calnexin/calreticulin 0.0000000399
Further Details:      
 
Domain Number 2 Region: 243-381
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.22e-57
Family P-domain of calnexin/calreticulin 0.000000294
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006220
Domain Number - Region: 384-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000111
Family Calnexin/calreticulin 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006220   Gene: ENSNLEG00000005101   Transcript: ENSNLET00000006536
Sequence length 593
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:6481419:6516473:-1 gene:ENSNLEG00000005101 transcript:ENSNLET00000006536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHEFMDDDVEMEDFEENSEEIDVNEGELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLS
KAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAIAAVLAKPFIFADKPL
IVQYEVNFQDGIDCGGAYIKLLADTDDLILDNFYDKTSYIIMFGPDKCGEDYKLHFIFRH
KHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMKPDDTFEVLVDQTVVNKGSLLEDV
VPPINPPKEVEDPNDKKPEEWDERAKIPDPSAIKPEDWDESEPAQIEDSSVVKPAGWLDD
EPKFIPDPNAEKPDDWNEDMEGEWEAPQILNPACQIGCGEWKPPMIDNPKYKGVWRPPLV
DNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVAD
HWAADGWRWKIMIANANEPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVK
KKYKDTAYKKTDICIPQTKGVLEQEGKEEKAALEKSMDLEEEKKQNDGEMLEKEEESEPE
EKSEEEIEIIKGQEERNKSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD
Download sequence
Identical sequences ENSNLEP00000006220 XP_003258188.2.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]