SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006221 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006221
Domain Number 1 Region: 425-682
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-73
Family Eukaryotic proteases 0.000000000807
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-30
Family Spermadhesin, CUB domain 0.000000383
Further Details:      
 
Domain Number 3 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-24
Family Spermadhesin, CUB domain 0.0000676
Further Details:      
 
Domain Number 4 Region: 359-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.000011
Further Details:      
 
Domain Number 5 Region: 298-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000101
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000571
Family EGF-type module 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006221   Gene: ENSNLEG00000005106   Transcript: ENSNLET00000006537
Sequence length 688
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:7003837:7014215:1 gene:ENSNLEG00000005106 transcript:ENSNLET00000006537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDAPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTVRREDFDVEPADSEGNCLDSLVF
VAGDQQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGHVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVTRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALIDEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKQLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
ENPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYVAGLVSWGPQCG
TYGLYTRVQNYVDWIMKTMQENSTPRED
Download sequence
Identical sequences XP_003273823.1.23891 ENSNLEP00000006221 ENSNLEP00000006221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]