SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006328 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006328
Domain Number 1 Region: 163-361
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.75e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 378-454
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.63e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000006328
Domain Number - Region: 609-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006328   Gene: ENSNLEG00000005231   Transcript: ENSNLET00000006650
Sequence length 690
Comment pep:known_by_projection supercontig:Nleu1.0:GL397331.1:11249029:11258663:-1 gene:ENSNLEG00000005231 transcript:ENSNLET00000006650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPHQPVHLAQVSFVIPAFNSNLTLDLELNHHLLSSQYVERHFSREGTTQHSTGAGDHCYY
QGKLRGNPHSFAALSTCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLP
DPLGCREPGKGGKGGWXXXXXTDSKCPPTPQVRRGHPTVHSETKYVELIVINDHQLFEQM
RQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVY
RREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSRGGGVNEYGNMGAMAVTLAQTLG
QNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLF
NKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCK
YEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQ
ALWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDL
VGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFS
TCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNI
IIGSIAGAVLVAAIVLGGTGWGFKNIRRGR
Download sequence
Identical sequences ENSNLEP00000006328 ENSNLEP00000006328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]