SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000006763 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000006763
Domain Number 1 Region: 1155-1443
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 6.02e-33
Family Tricorn protease domain 2 0.03
Further Details:      
 
Domain Number 2 Region: 901-1067,1134-1262
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.73e-27
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 3 Region: 306-507
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000328
Family Extended AAA-ATPase domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000006763   Gene: ENSNLEG00000005585   Transcript: ENSNLET00000007102
Sequence length 1538
Comment pep:known_by_projection supercontig:Nleu1.0:GL397382.1:1985413:2068369:1 gene:ENSNLEG00000005585 transcript:ENSNLET00000007102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRGKPCRALPTLKQTFCQKHGLMFEVVDLRWGIRNIEATDCLTTELCLEEVDRCWKTSIG
PAFVALIGDQYGPCLVPSRIDEKEWEVLRAHLTARPSDLELVARHFQRDENAVPPTYILQ
APGTGEACEPEEANLTSVLRSGAQKAWRLGLITQEQWQRYHRSVIEWEIERGLLSSEDRD
QGATVFLREIQDLHKHILEDCALRMVDRLADGCLGTDAQNLLSSLKGHITDMHPGVLKAH
RLPWSRDLVNPKNKTHARYLKELGEQFVVRANHQVLTRLRELDTAGQELAWLYQEIRHHL
WQSSEITQTFCGRQELLAQLGQQLRHDDSKQHTPLVLFGPPGIGKTALMCKLAEQMPRLL
GHKTVTILRLLGTSQMSSDARSLLKSICFQVCLAYGLPLPPAQVLDTHTRVVQFFHTLLH
TVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPLNCPPSVHLILSACSGALGVLDTLQRV
LLDPEAYWEVKPLSGNQGQEMIQLLLAAARRTLRPVHTDLLWASLPECGNPGQLRLAFEE
ARRWASFTVPASLATTAEEATHQLCARLEQTHGRLLVAHVLGYVVSSRHGLSEAELKDVL
SLDDEVLQDVYRDWTPPSKELLRFPPLLWVRLRRDLEYYLARRPVDGFTLLAIAHRQLVE
VVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLITLPLVGKPLNLDRKVAPQPLWFSDA
VANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSP
EVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQNWFRLCA
HPVLVPLGGFLQPPGGPLRATLSGSFLYSLFAGGISKLTIILIVARSKCSQLIYSPLPWP
ASGEVRCVKIFAKGTLAISASKDYTLRLWNLLSGQEKFTIWDGGSKNPTEPQIWNLHVDE
AHKVVYSASGSKINAWNLETAEPVFHILGDVSDPWMCMAVLASQATLLTVSRDGVVSLWS
SATGKLQGKQHMSSTKEETPTCAVSVQKQGKLVTGFSNGSICLVSSKGDRLLEKLPDAVR
FLVVSEDESLLAAVVRKLIRIRLEKGPPKVLGLQARCQICPPVLLPQVWSLSEHGTLLDI
LEGVGAPVSLLARGGALVASASPQSSSFKIWDLSNAHRSRAPAPFLDRTGLTAVSHNGSY
VYFPKIGDKNKVTIWNLAEGEEQDSLDTSSEVRCLEVAEQRKLLFTGLVSGVVLVFPLNS
RQDVICIPPPEARKAVNCMSLSKCEDRLAIAYDNIVLVLDITPGDPCPVIDGPRYTFYTQ
LPETLSNVAILTDYRVVYGMTNGDLFLYECANSKVFPLEAHRSRVACVEVSHKEQLVVSG
SEDALLCLWDLQARKWKFEMSYTSSYCRGVQCACFSKDDKYVYVGLKDRSILVWSVLDGT
LLTVQFVHAVVNRIIPTTGGFIAPTRHGYLIREHFQCLSARALPQDSLTNFKKAVWMVKS
RQREELVAAAGAPQDLESENAQGNETKSNKCSQVCLIV
Download sequence
Identical sequences ENSNLEP00000006763 ENSNLEP00000006763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]