SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007086 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007086
Domain Number 1 Region: 8-109
Classification Level Classification E-value
Superfamily POZ domain 1.05e-20
Family BTB/POZ domain 0.0021
Further Details:      
 
Domain Number 2 Region: 531-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000388
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 492-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000011
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 460-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000209
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007086   Gene: ENSNLEG00000005859   Transcript: ENSNLET00000007438
Sequence length 744
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:31176702:31183587:1 gene:ENSNLEG00000005859 transcript:ENSNLET00000007438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLNEQRLFQPDLCDVDLVLVPQRSVFPAHKGVLAAYSQFFHSLFTQNKQLQRVELSLE
ALAPGGLQQILNFIYTSKLLVNAANVHEVLSAASLLQMADIAASCQELLDARSLGPPGPG
TVALAQPAASCTPAAPPYYCDIKQEADTPGLPKIYAREGPDPYSVRVEDGAGTAGGTVPA
TIGPGQPFFKEEKEGGVEEAGGPPASLCKLEGGEELEEELGGSGTYSRREQSQIIVEVNL
NNQTLHVSTGPEGKPGAGPSPATMVLGREDGLQRHSDEEEEDDEEEEEEEEEEEGGGSGR
EEEEEEEEEGGSQGEEEEEEEDGHSEQEEEEEEEEEEGPSEQDQESSEEEEGEEGEAGGK
QGPRGNQGSRGDPPSHSHMATRSRENARRRGTPELEEVGQRGGKRPKPPPGVASASARGP
PATDGLGAKVKLEEKQHHPCQKCPRVFNNRWYLEKHMNVTHSRMQICDQCGKRFLLESEL
LLHRQTDCERNIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEICEKKFYTMAHVRKH
MVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCEGPEREAHPLRSAAPASHSH
PAPTLLWPTPILPFLPQPSPTHSGWEVCVGCSPRSRLSGEADQEHPRPGAQMRQQSCRWG
GELFPPQRLLFCSAHKEKCFRVSHPLAGDGAPAAPGLPPTQPQAHALPLLPGLPQTLPPP
PHLPPPPPLFPTTASPGGRMNANN
Download sequence
Identical sequences ENSNLEP00000007086 ENSNLEP00000007086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]