SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007349 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007349
Domain Number 1 Region: 941-1010
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-18
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 2 Region: 2046-2115
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.97e-18
Family TB module/8-cys domain 0.00000692
Further Details:      
 
Domain Number 3 Region: 1840-1971
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 2324-2394
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-17
Family TB module/8-cys domain 0.00048
Further Details:      
 
Domain Number 5 Region: 1105-1231
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 1524-1619
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-17
Family TB module/8-cys domain 0.00000916
Further Details:      
 
Domain Number 7 Region: 2439-2565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 528-648
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 9 Region: 442-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 2123-2252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 173-258
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 12 Region: 1019-1160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1678-1744
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 14 Region: 319-385
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 15 Region: 838-922
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000209
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 16 Region: 1189-1327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000361
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 17 Region: 643-713
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000602
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 18 Region: 1396-1528
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000698
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 19 Region: 2565-2681
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 20 Region: 759-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000466
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 21 Region: 717-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000518
Family EGF-type module 0.008
Further Details:      
 
Domain Number 22 Region: 2001-2049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000271
Family EGF-type module 0.005
Further Details:      
 
Domain Number 23 Region: 1759-1808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 24 Region: 1598-1647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000552
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 25 Region: 278-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000121
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 26 Region: 1960-2004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.004
Further Details:      
 
Domain Number 27 Region: 1360-1398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000431
Family EGF-type module 0.046
Further Details:      
 
Domain Number 28 Region: 2400-2444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 29 Region: 2278-2327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000718
Family EGF-type module 0.007
Further Details:      
 
Domain Number 30 Region: 1319-1357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.019
Further Details:      
 
Domain Number 31 Region: 1798-1838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000345
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 32 Region: 1640-1683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 33 Region: 801-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000734
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 34 Region: 2241-2283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000926
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007349
Domain Number - Region: 144-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007349   Gene: ENSNLEG00000006015   Transcript: ENSNLET00000007713
Sequence length 2865
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:9429285:9675705:-1 gene:ENSNLEG00000006015 transcript:ENSNLET00000007713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEIFLGFIVILASYTSHGADANLEAGNVKETRASRAKRRGGGGHDALKGPNVCGSRYNAY
CCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCNIRCMNG
GSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERDYRTGPC
FTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQD
VDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGICDGGECTN
TVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGRCW
SPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVVPVPPGFPPVPQIP
VPRPPVEYPYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKGFQLDLRG
ECIDVDECEKNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRICNNGRC
INTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLAS
DGRFCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYK
RGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSAGSDINE
CALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQCRNTPG
SFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDPTKTICI
ETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYSRIKGT
QCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFLRYEDEE
CTLPIAGRHRMDTCCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEITNGKPFF
KDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQC
VNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQL
SPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNG
GCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCY
DGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINEC
EIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGS
YRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSADGKACED
IDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISGNCVNTP
GSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKASCCCSL
GKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTF
GSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQVNGGNN
CMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPSTDEFAT
LCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYNDKLLVC
EDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNICSHGQCI
DTVGSFYCLCHTGFKTNDDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGFILSHNN
DCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLEPRKCAP
GTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLCPEGFSL
SSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCPTEPDEA
FRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILAGNECVD
TDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFRCVNTYG
SYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGYQRRPDG
EGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCFTEVLQN
MCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNGADIDEC
KVIHDVCRHGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICKNTEGSY
QCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHTACIDNN
ECTSDISLCGAKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGNHRCQHGCQNIIG
GYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSGGC
QDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRGNPEPSVSGEMD
DNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEKTAIFAF
NISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVVGT
YSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Download sequence
Identical sequences A0A2I3GUR3
ENSNLEP00000007349 ENSNLEP00000007349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]