SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007405 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007405
Domain Number 1 Region: 218-298
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000103
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007405
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 447-544
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.017
Family Apolipoprotein A-I 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007405   Gene: ENSNLEG00000006104   Transcript: ENSNLET00000007771
Sequence length 802
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:5336723:5342419:1 gene:ENSNLEG00000006104 transcript:ENSNLET00000007771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYLGF
ERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKTGGWAWIYCLLYS
EGPEGPITANNYPISDMEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENILSQEQCSSTN
PLFTAALGAPRSTSFPSAPELSVVSASEELPRPSKELDFSYLTFPSGPEPSLQAELSKDL
VCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPNTATFSDQLTPSSATFPDP
LTSPLQGQLTETSVRSYEDQLTPCTSTFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQA
HLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLE
PLGGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADPDNMFLEETPVEDIFMDLSTP
DPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDEL
HQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences G1R2I3
XP_003273945.1.23891 ENSNLEP00000007405 ENSNLEP00000007405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]