SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007407 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007407
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.28e-24
Family Ribosomal L11/L12e N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.18e-17
Family Ribosomal protein L11, C-terminal domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007407   Gene: ENSNLEG00000006111   Transcript: ENSNLET00000007773
Sequence length 181
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:5351565:5355358:-1 gene:ENSNLEG00000006111 transcript:ENSNLET00000007773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLGRATRGLRKPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDI
KEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEI
ALIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKERCSANVLRNGKISMKDPSGRSS
V
Download sequence
Identical sequences A0A2I3GW90
ENSNLEP00000007407 XP_003273946.1.23891 ENSNLEP00000007407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]