SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007438 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007438
Domain Number 1 Region: 24-353
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.26e-129
Family Transferrin 0.0000000000134
Further Details:      
 
Domain Number 2 Region: 355-455
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.21e-28
Family Transferrin 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007438   Gene: ENSNLEG00000006121   Transcript: ENSNLET00000007804
Sequence length 468
Comment pep:novel supercontig:Nleu1.0:GL397269.1:34757492:34776435:-1 gene:ENSNLEG00000006121 transcript:ENSNLET00000007804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLVFPALLFLGALGLCLAAPRRRSVRWCTISQPEATKCFQWQRNMRRVRGPPVSCIKTA
SPIQCVQAIATNRADAVTLDGGLIYEAGLAPYKLRPVAAEVYGTEGQPRTHYYAVAVVKK
GSRFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPLEAAVARFFSASCVPG
ADKGQFPNLCRLCVGTGENKCAFSSQEPYFGYSGAFKCLREGAGDVAFIRESTVFEDLSD
EAERDNYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGREDAIWELLRQAQEKFGK
DKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEKEVAA
RRARVVWCAVGEQELRKCNQWSSLSEGNVTCSSASTTEDCIALVLKGEADAMSLDGGYVY
TAGKCGLVPVLAENYKSQQSSDPGPKCVDRPVEGELALATFRIKDKFL
Download sequence
Identical sequences ENSNLEP00000007438 ENSNLEP00000007438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]