SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007450 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007450
Domain Number 1 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family Cripto EGF-like domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 78-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000656
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007450   Gene: ENSNLEG00000006143   Transcript: ENSNLET00000007816
Sequence length 188
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:34884293:34887658:1 gene:ENSNLEG00000006143 transcript:ENSNLET00000007816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCRKMARFSYSVVWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIRPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHNVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGI
CLSIQSYY
Download sequence
Identical sequences G1R2M8
ENSNLEP00000007450 XP_003257032.1.23891 ENSNLEP00000007450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]