SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007725 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007725
Domain Number 1 Region: 8-127
Classification Level Classification E-value
Superfamily DNA clamp 2.23e-17
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007725   Gene: ENSNLEG00000006355   Transcript: ENSNLET00000008097
Sequence length 390
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:6337875:6344898:1 gene:ENSNLEG00000006355 transcript:ENSNLET00000008097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGATKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQY
QAATPGQDLLRCKILMKSFLSVFRSLATLEKTVEKCCISLNGRSSRLVVQLHCKFGXXKT
HNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFPPALAEVTLGIGRGRRVILRSY
HEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVSITFCLKEFRGLLSFAESANLNLSIHFD
APGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSVPHPDDFAND
DIDSYMIAMETTIGNEGSRALSSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKF
RSLFFGSILAPVRSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences ENSNLEP00000007725 ENSNLEP00000007725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]