SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007761 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007761
Domain Number 1 Region: 123-406
Classification Level Classification E-value
Superfamily L domain-like 1.09e-52
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 426-730
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.95e-42
Family Rhodopsin-like 0.00053
Further Details:      
 
Domain Number 3 Region: 48-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007761   Gene: ENSNLEG00000006346   Transcript: ENSNLET00000008135
Sequence length 779
Comment pep:known_by_projection supercontig:Nleu1.0:GL397272.1:24684400:24821236:1 gene:ENSNLEG00000006346 transcript:ENSNLET00000008135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRNQDQILLTFINQLLAEKEMTSGSVFFYILIVGKYFSHGGGQDIKCSLGYFPCGNIT
KCLPQLLHCNGVDDCGNQADEDNCGDNNGWSLQFDKYFASYYKMTSQYPFETETPECLVG
SVPVQCLCRGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQ
NNKITSISIYAFRGLNSLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTF
YGLNSLILLVLMNNVLTRLPDKPLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVM
RKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQ
FDYLVKLKSLSLEGIEISNIQRRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISS
LENLLASIIQRVFVWVVSAVTCFGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGVYL
FVIGGFDLKFRGEYNKHAQLWMESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPF
RCVRPGKCRTVTVLILIWITGFIVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQI
YSVAIFLGINLAAFIIIVFSYGSMFYNVHQSAITATEIRNQVKKEMILAKRFFFIVFTDA
LCWIPIFVVKFLSLLQVEIPGTITSWVVIFILPINSALNPILYTLTTRPFKEMIHQFWYN
YRQRRSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS
Download sequence
Identical sequences G1R3I9
ENSNLEP00000007761 XP_003257951.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]