SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007843 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007843
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily LysM domain 0.000000000942
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007843   Gene: ENSNLEG00000006444   Transcript: ENSNLET00000008218
Sequence length 215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:12780040:12795885:-1 gene:ENSNLEG00000006444 transcript:ENSNLET00000008218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSPALSLREGGPRAPRPSAPSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
KPLLFNGLNSIDSPENETVDNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFL
QRLDLQIKLSTQAAKKLKEESRDEESPYATSLYHS
Download sequence
Identical sequences A0A2I3GAC9
ENSNLEP00000007843 XP_003266983.1.23891 ENSNLEP00000007843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]