SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007906 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007906
Domain Number 1 Region: 2184-2278
Classification Level Classification E-value
Superfamily C-type lectin-like 3.58e-31
Family Link domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1558-1713
Classification Level Classification E-value
Superfamily FAS1 domain 8.5e-30
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 3 Region: 964-1115
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-27
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 511-641
Classification Level Classification E-value
Superfamily FAS1 domain 1.14e-24
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1728-1868
Classification Level Classification E-value
Superfamily FAS1 domain 1.24e-23
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 6 Region: 1130-1251
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-21
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 7 Region: 2274-2435
Classification Level Classification E-value
Superfamily FAS1 domain 3.14e-21
Family FAS1 domain 0.0091
Further Details:      
 
Domain Number 8 Region: 367-490
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-19
Family FAS1 domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1460-1499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000119
Family EGF-like domain of nidogen-1 0.071
Further Details:      
 
Domain Number 10 Region: 1502-1540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Merozoite surface protein 1 (MSP-1) 0.086
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000007906
Domain Number - Region: 220-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000223
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 2072-2108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00072
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 311-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00093
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 2118-2151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 1371-1497
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 1986-2109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 863-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-like domain of nidogen-1 0.079
Further Details:      
 
Domain Number - Region: 907-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 184-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0093
Family Merozoite surface protein 1 (MSP-1) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007906   Gene: ENSNLEG00000006418   Transcript: ENSNLET00000008285
Sequence length 2537
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:8531458:8707549:1 gene:ENSNLEG00000006418 transcript:ENSNLET00000008285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTKITSGSVGVRDCRYT
FEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPCNGRGSCAEGMEGNG
TCSCQEGFGGTACETCADDNLFGPSCSAVCNCVHGVCNSGLDGDGTCECYSAYTGPKCDK
PIPECAALLCPENSRCSPSTEDENKLECKCLPNYQGDGKYCEPINPCLQKICHPHAHCTY
LGPNQHSCTCQEGYHGDGQVCLPVDPCQINFGNCPTKSTVCKYDGPGQSHCECKEHYQNF
VPGVGCSMTDICKSNNLCHRNANCTTIAPGRTECICQKGYVGDGLTCYGNIMERLRELNT
EPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFDINELLVDNKAAQYFV
KLHIIAGQMNTEYMNNTDTFYTLTGKSGEIFNSDKDNQIKLKLHGGKKKVKIIQGDIIAS
NGLLHILDRAMDKLEPTFESNSEQTIVTMLQPRYSKFRSLLEETNLGHALDEDGVGGPYT
IFVPSNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVATLISTPHIRSMANQ
LIQFNTTDNGQILANDVAMEEIEITAKNGRIYTLTGVLIPPSIVPILPHRCDETKREMKL
GTCVSCSLVYWSRCPANSEPTALFTHRCVYSGRFGSLKSGCARYCNATVKIPKCCKGFYG
PDCNQCPGGFSNPCSGNGQCADSLGGSGTCICEEGFQGSQCQFCSDPNKYGPRCNKKCLC
VHGTCDNRIDSDGACLTGTCRDGSAGRLCDKQTSACGPYVQFCHIHATCEYSNGTASCIC
KAGYEGDGTVCSEMDPCTGLTPGGCSRNAECIKTGMGTHTCVCQQGWTGNGRDCLEINNC
LLPSAGGCHDNATCLYVGPGQNECECKKGFRGNGIDCEPITSCLEQTGKCHPLANCQSTS
SGVWSCVCQVGYEGDGFLCYGNAAVELSFLSEAAIFNQWINDASLQLILSATSNLTVLVP
SQQATEDMDQDEKSFWLSQSNIPALIKYHMLLGTYRVADLQTLSSSDMLATSLQGNFLHL
ANVDGNITIEGASIVDGDNAATNGVIHIINKVLVPQRHLTGSLPNLLMRLEQMPDYSIFR
GYIIQYNLANAIEAADAYTVFAPNNNAIENYIREKKVLSLEEDVLRYHVVLEEKLLKNDL
HNGMHRETMLGFSYFLGFFLHNDQLYVNEAPINYTNVATDKGVIHGLGKVLEIQRNRCDN
NDTTIIRGKCRTCFSEPICPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRTVITR
ECCAGFFGPQCQPCPGNAQNVCFGNGICLDGVNGTGVCECGEGFSGTACETCTEGKYGIH
CDQACSCVHGRCNQGPLGDGSCDCDVGWRGVHCENATTEDNCNGTCHTSANCLPNSDGTA
SCKCAAGFQGNGTICTAINACEISNGGCSAKADCKRTAPGRRVCTCKAGYTGDGIVCLEI
NPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGKVCTLINVCLTKNGGCSEFAICNH
TGQGERTCTCKPNYVGDGFTCRGSIYQELPKNPKTSQYFFQLQEHLVKDLVGPGPFTVFA
PLSAAFDEEARVRDWDKQGLMPQVLRYHVVACHQLLLENLKLISNATSLQGEPIVISVSQ
GTVYINNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDTSGRILQNLTTLATNNGYI
KFSSLIQDSGLLSVITDPIHTPVTLFWPTDQALQALPAEQQDFLFNQDNKDKLKEYLKFH
VIRDAKVLAVDLPTSTAWKTLQGSELSVKCGAGSDIGDLFLNGQTCRIVQRELLFDLGVA
YGIDCLLIDPTLGGRCDTFTTFDASGECGSCVNTPSCPRWSKPKGVKQKCLYNLPFKRNL
EGCRERCSLVIQIPKCCKGYFGRECQACPGGPDAPCNNRGVCLDQYSATGECKCNTGFNG
TACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPSCDTQAVLPAVCTPP
CSAHATCKENNTCECKLDYEGDGITCTVVDFCKQDNGGCAKVARCSQKGTKVSCSCQKGY
KGDGRSCTEIDPCADGLNGGCHEHATCKMTGPGKHKCDCKSHYVGDGLNCEPEQLPIDRC
LQDNGQCHADAKCVDLHFQDTTVGVFHLRSPLGQYKLTFDKAKEACANEAATVATYNQLS
YAQKAKYHLCSAGWLESGRVAYPTAFASQNCGSGVVGIVDYGPRPNKSEMWDVFCYRMKD
VNCTCKVGYVGDGFSCSGNLLQVLMSFPSLTNFLTEVLAYSNSSARGRAFLEHLTDLSIR
GTLFVPQNSGLGENETLSGRDIEHHLVNVSMFFYNDLVNGTTLQTRLGSKLLITASQDLL
QPTETRFVDGRAILQWDIFASNGIIHVISRPLKAPPAPMTLTHTGLGAGIFFAIILVIGA
VALAAYSYFRINRRTIGFQHFESEEDINAAALGKQPPENISNPLYESTTSAPPEPSYDPF
TDSEERQLEGNDPLGTL
Download sequence
Identical sequences ENSNLEP00000007906 ENSNLEP00000007906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]