SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007908 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007908
Domain Number 1 Region: 26-451
Classification Level Classification E-value
Superfamily ALDH-like 1.24e-124
Family ALDH-like 0.000000000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007908   Gene: ENSNLEG00000006499   Transcript: ENSNLET00000008287
Sequence length 486
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:6599829:6610188:-1 gene:ENSNLEG00000006499 transcript:ENSNLET00000008287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKKGSGGAAKEPGAETTPGMDPFEDTLRRLREAFNSGRTRPAEFRAAQLQGLGRFLQEN
KQLLCNVLAQDLHKSAFEADVSELILCQNEVDYALKNLQAWMKDEPRSTNLFTKLDSVFI
RKEPFGLVLIIAPWNYPVNLTLVPLVGALAAGNCVVLKPSEISQGTEKVLAEVLPQYLDQ
SCFAVVLGGPQETGQLLEHKFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVD
DNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSP
NLGRIINQKQFQRLRALLGCGRVAIGGQSDESDRYIAPTVLVDVQETEPVMQEEIFGPIL
PIVNVRSVDEAIEFINRREKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYTTLLSV
PFGGVGHSGMGQYHGKFTFDTFSHHRTCLLAPSGLEKLKEIRYPPYTDWNQQLLSWGMGS
QSCTLL
Download sequence
Identical sequences ENSNLEP00000007908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]