SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000007930 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000007930
Domain Number 1 Region: 29-461
Classification Level Classification E-value
Superfamily ALDH-like 8.64e-124
Family ALDH-like 0.000000000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000007930   Gene: ENSNLEG00000006517   Transcript: ENSNLET00000008313
Sequence length 491
Comment pep:known_by_projection supercontig:Nleu1.0:GL397360.1:6666777:6684614:1 gene:ENSNLEG00000006517 transcript:ENSNLET00000008313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLTAGPPGRAGQPGGRATWQSLRMDPFEDTLRRLREAFHAGCTRPAEFRAAQLRGLGRFL
QENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDS
AFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKVLAEVLPRY
LDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPC
YVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQ
SSPNLGRIINQKQFQRLRALLGCGRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFG
PILPIVNVQSVDEAIEFINRREKPLALYAFSNXXXVVKRVLTQTSSGGFCGNDGFMHMTL
ASLPFGGVGASGMGRYHGKFSFDTFSHHRACLLRSPGMEKLNALRYPPQSPRRLRVLLVA
METRGCSCTLL
Download sequence
Identical sequences ENSNLEP00000007930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]