SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008150 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008150
Domain Number 1 Region: 403-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.94e-77
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-33
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-31
Family Spermadhesin, CUB domain 0.0000249
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000122
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008150   Gene: ENSNLEG00000006685   Transcript: ENSNLET00000008537
Sequence length 728
Comment pep:known_by_projection supercontig:Nleu1.0:GL397268.1:41286156:41343368:-1 gene:ENSNLEG00000006685 transcript:ENSNLET00000008537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLYYALCFSLSKASAHTVELNDMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVFGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYSFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKIVDCRAPGELEHGLFTFSTRNNLTTYKSEIKYSCQEPYYKMLNNITGIYTCSAQGVW
MNKILGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSESWILTAAHVLRSQRRDSTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVV
LHPDFNIQNYNHDIALVQLQEPVPLGPHVVPVCLPRLEPEGPAPHMLGLVAGWGISNPNV
TVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPQS
AGEPQVER
Download sequence
Identical sequences A0A2I3GNR6
XP_003256676.1.23891 ENSNLEP00000008150 ENSNLEP00000008150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]