SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008440 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008440
Domain Number 1 Region: 1045-1093
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 2.16e-17
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 2 Region: 265-370
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.03e-16
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.001
Further Details:      
 
Domain Number 3 Region: 121-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000393
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 4 Region: 34-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000218
Family HLH, helix-loop-helix DNA-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008440   Gene: ENSNLEG00000006923   Transcript: ENSNLET00000008839
Sequence length 1415
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:11352933:11500126:1 gene:ENSNLEG00000006923 transcript:ENSNLET00000008839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGENLDPLATDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCTILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGE
DLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLA
DPSTTGQMSGARYGGSSNIASLTPGSGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNI
MISPRNRGSPKIASHQFSPVSGVHSPMGSSGNTGNHSFSSSSLSALQAISEGVGTSLLST
LSSPGPKLDNSPNMNITQPSKVSSQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
SSVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVS
SSTPGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGN
VVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQE
KDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSVSSNGSHLGTKQQVFQGTNSLGLK
SPQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
SMGGPNRNVTVTQTPSSGEWSLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSMPT
LPLRSNSIPAARPILQPQQQQQQMLQMRPGEIPMGMGANPYGQAASSNQLGSWPNGMLSM
EQVPHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALG
IPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSSSFNS
MMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQSLELKVEN
PTAGGAAVMRPMMQPQQSFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQ
QQQQQQQTQAFSPPPNVTASPSMDGLLAGPAMPQAPPQQFPYQPNYGMGQQPDPAFGRVS
SPSNAMMSSRMGASQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAV
YSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC
Download sequence
Identical sequences XP_003252953.1.23891 ENSNLEP00000008440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]