SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008450 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008450
Domain Number 1 Region: 2888-3067
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-36
Family Laminin G-like module 0.00000553
Further Details:      
 
Domain Number 2 Region: 2294-2481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-35
Family Laminin G-like module 0.00099
Further Details:      
 
Domain Number 3 Region: 2714-2879
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-33
Family Laminin G-like module 0.0000509
Further Details:      
 
Domain Number 4 Region: 2127-2293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.01e-29
Family Laminin G-like module 0.00088
Further Details:      
 
Domain Number 5 Region: 2477-2672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.8e-27
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 6 Region: 846-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000865
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 7 Region: 796-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1400-1451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000155
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 267-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000222
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1041-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 12 Region: 899-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000206
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 13 Region: 394-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family Laminin-type module 0.059
Further Details:      
 
Domain Number 14 Region: 451-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 15 Region: 1507-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 16 Region: 948-997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 17 Region: 324-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000229
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 18 Region: 992-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 19 Region: 702-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.059
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008450
Domain Number - Region: 75-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00034
Family APC10-like 0.059
Further Details:      
 
Domain Number - Region: 1358-1382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00226
Family Laminin-type module 0.055
Further Details:      
 
Domain Number - Region: 1087-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008450   Gene: ENSNLEG00000006930   Transcript: ENSNLET00000008849
Sequence length 3071
Comment pep:known_by_projection supercontig:Nleu1.0:GL397285.1:23928505:24103724:-1 gene:ENSNLEG00000006930 transcript:ENSNLET00000008849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVLLALLLCVAARCQQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRPVRN
PQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVI
IKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEVICT
SYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSH
REPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGESCNR
CCPGYHQQPWRPGTVSSGNTCEACNCHNKAEDCYYDESVAKQKKSLNTAGQFRGGGVCIN
CLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCDCDPVGSLSSVCIKDDLHSDLHNGKW
PGQCLCKEGYAGEKCDRCQLGYKDYPTCVSCGCNPVGSANDEPCTGPCVCKENVEGKACD
RCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNNMSGWLVTDLISPRKIPSQQ
DALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGVLKYTVSYDIPVETVDSN
LMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFRDFHSKRQIDRDQLMTVL
ANVTHLLIRANYNSAKMALYRLESVSLDIASPNAIDLAVAADVEHCECPQGYTGTSCESC
LSGYYRVDGILFGGICQPCECHGHAAECDVHGVCIACAHNTTGDHCEQCLPGFYGEPSRG
TLKDCQPCACPLTIASNNFSPTCHLNDGDEVVCDRCAPGYSGAWCERCADGYYGNPTVPG
ESCVPCDCSGNVDPLEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACE
CHVKGSHYAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCWPCNCSMAGSVSDDC
TDEGQCHCVPGVAGKRCDRCARGFYAYQDGSCTPCDCPHTQNTCDPGTGECVCPPHTQGV
KCEECEDGHWGYDVEVGCQACNCSLVGSTHHRCDVVTGHCQCESKFGGRACDQCSLGYRD
FPDCVPCDCDLRGTSGDACNLEQGLCGCAEETGACPCKENVFGPQCNECREGTFALRADN
PLGCSPCFCSGLSHLCSELEGYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPDFLL
DAATVRQHIHAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLIKGG
RIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYILIK
ASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHRG
KLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPDTGKCLNCVDNTAGDHCDVCASGYYGKVT
GSASDCALCACPHSPPASFSPTCVLEGDHNFRCDACLLGYEGQHCERYMGGLSRGNPGSH
GGCCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDECVG
VLLNDLDEIGDAILSLNLTGIIPVPYGILSNLENTTRYLQESLLKENMQKDLGKIKLEGV
AEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQTLD
EDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQSATLELRAAEDLLSQIQENYQKPLEE
LEVLKEAASHLLLKHNNELKAAEALVREAEAKTQESNHLLLMVNANLREFSDKKLHVQEE
QNLTSELIAQGRGLIDAAAAQTDAVQDALEHLEDHQDMLLLWSAKIRHHIDDLVMHMSQR
NALDLVYRAEDLAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELARD
AHRTVSETSLFSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIAWELSELRNKTNRFQEN
AVEITRQTNESLLILRAIPERIRDKGARTKELATSASQSAVSTLRDVAGLSQELLNTSAS
LSRVNTTLQETHQLLQDSTMATLLAGRKVKDVETQANLLFDRLKPLKMLEENLSRNLSEI
KLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGSST
TSDFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEMSE
FHHTNKNKIPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGKSIGL
WNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNGLLLY
LGSHGTKDFLSIELFRGRVKVMTDLGSGPLTLLTDRRYNNGTWYKIAFQRNRKQGVLAVI
DAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKNLEIS
RSTFDLLRNSYGVRKGCSLEPIRSVSFLKGGYVELPPKSLSPESEWLVTFATTNSSGIIL
AALGRDVEKRGDREEAHVPFFSIMLIGGNVEVHVNPGDGTGLRKALLHAPTGTCSDGQAH
SISLLRNRRIITVQLDENNPVEMKLGPLVESRTINVSNLYVGGIPEGEGTSLLTMRRSFH
GCIKNLIYNLELLDFNSAVGHEQVDLDTCWLSERPKPAPDAEDSKLLPEPRAFPEHCVAD
AALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQADYA
VLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGQESPTVTVV
GDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAFTVNR
CYAVAQEGTFFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAIGLEL
VDGKVLFHVNNGAGRITAAYEPKTATALCDGKWHTLQANKSKHRITLIVDGNAVGAESPH
TQSTSVDTNNPIYVGGYPAGVKQKCLHSQTSFRGCLRKLALIKSPQVQSFDFSRAFELHG
VFLHSCPGTES
Download sequence
Identical sequences ENSNLEP00000008450 ENSNLEP00000008450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]