SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008512 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008512
Domain Number 1 Region: 30-348
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.21e-112
Family Bee venom hyaluronidase 0.0000117
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008512
Domain Number - Region: 389-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008512   Gene: ENSNLEG00000006981   Transcript: ENSNLET00000008914
Sequence length 417
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:38528013:38530897:-1 gene:ENSNLEG00000006981 transcript:ENSNLET00000008914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQLGPALVLGVALCLGYGQPLPQVPERPFSVLWNVPSAHCNARFGVHLPLNALGIIAN
RGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARAL
MEDTLRLAQALRPHGLWGFYHYPACGNGWPSMASNYTGRCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
LVQTVGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQR
CHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRLGPKEAV
Download sequence
Identical sequences G1R5P0
ENSNLEP00000008512 XP_003257146.1.23891 ENSNLEP00000008512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]