SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008539 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008539
Domain Number 1 Region: 223-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-50
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 63-177
Classification Level Classification E-value
Superfamily POZ domain 6.28e-28
Family Tetramerization domain of potassium channels 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008539   Gene: ENSNLEG00000007001   Transcript: ENSNLET00000008942
Sequence length 513
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:14869347:14889723:-1 gene:ENSNLEG00000007001 transcript:ENSNLET00000008942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPED
RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMV
EREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
Download sequence
Identical sequences G1R5R7 G3QEX6 H2P2B0 H2R2Y3 Q9UIX4
ENSPTRP00000044623 ENSPTRP00000044623 ENSGGOP00000000831 ENSPPYP00000012440 NP_002228.2.87134 NP_002228.2.92137 XP_003252984.1.23891 XP_003815317.1.60992 XP_006723848.1.92137 XP_008966451.1.60992 XP_008966452.1.60992 XP_008966453.1.60992 XP_008966457.1.60992 XP_011527102.1.92137 XP_011527103.1.92137 XP_011527104.1.92137 XP_011527105.1.92137 XP_011527106.1.92137 XP_011527107.1.92137 XP_011527108.1.92137 XP_012367187.1.23891 XP_014198579.1.60992 XP_016793626.1.37143 XP_016793627.1.37143 XP_016793628.1.37143 XP_016793630.1.37143 XP_016793631.1.37143 XP_018872245.1.27298 XP_018872246.1.27298 XP_018872247.1.27298 XP_018872250.1.27298 9598.ENSPTRP00000044623 9600.ENSPPYP00000012440 9606.ENSP00000360626 ENSPPYP00000012440 ENSGGOP00000000831 gi|27436988|ref|NP_002228.2| ENSP00000360626 ENSP00000360626 ENSNLEP00000008539 ENSNLEP00000023968 ENSNLEP00000008539 ENSP00000360626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]