SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008663 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008663
Domain Number 1 Region: 298-494
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.08e-47
Family Reprolysin-like 0.00026
Further Details:      
 
Domain Number 2 Region: 511-586
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.71e-17
Family Blood coagulation inhibitor (disintegrin) 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000008663
Domain Number - Region: 742-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008663   Gene: ENSNLEG00000007102   Transcript: ENSNLET00000009075
Sequence length 832
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:50833431:51005565:1 gene:ENSNLEG00000007102 transcript:ENSNLET00000009075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGSSSRRPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASS
RPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY
INQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEI
HYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDE
KSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKY
LELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQID
ITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEY
RDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHC
SDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCY
NGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFL
LCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMC
LDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPP
KDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Download sequence
Identical sequences A0A2I3GIB3
XP_003254035.1.23891 ENSNLEP00000008663 ENSNLEP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]