SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008851 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008851
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 1.35e-27
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 2 Region: 1906-2073
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-26
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 909-1079
Classification Level Classification E-value
Superfamily Fibronectin type III 5.85e-25
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 4 Region: 1634-1800
Classification Level Classification E-value
Superfamily Fibronectin type III 6.52e-24
Family Fibronectin type III 0.0000105
Further Details:      
 
Domain Number 5 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 4.52e-23
Family Fibronectin type III 0.000007
Further Details:      
 
Domain Number 6 Region: 725-891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.97e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 347-402
Classification Level Classification E-value
Superfamily Kringle-like 1.03e-20
Family Fibronectin type II module 0.0000664
Further Details:      
 
Domain Number 9 Region: 1811-1901
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-19
Family Fibronectin type III 0.00000341
Further Details:      
 
Domain Number 10 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 3.5e-17
Family Fibronectin type III 0.00000264
Further Details:      
 
Domain Number 11 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000864
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 12 Region: 2340-2383
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000327
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000848
Family Fibronectin type III 0.00000328
Further Details:      
 
Domain Number 15 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000118
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 16 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 18 Region: 2295-2338
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000523
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 19 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 20 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2383-2424
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000012
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 24 Region: 2209-2273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000584
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 25 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000204
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008851   Gene: ENSNLEG00000007224   Transcript: ENSNLET00000009271
Sequence length 2477
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:59930568:60007027:-1 gene:ENSNLEG00000007224 transcript:ENSNLET00000009271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVLYLGTAVPSTGASKSKRQAQQMVQPQAPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVHAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTILVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNPVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPFSP
FVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPQSAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDTTVLVRWTPP
RAQITGYRLTIGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHISGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPVITHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYTQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE
Download sequence
Identical sequences G1R6M9
ENSNLEP00000008851 XP_003254087.1.23891 ENSNLEP00000008851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]