SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000008921 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000008921
Domain Number 1 Region: 33-213
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.31e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000111
Further Details:      
 
Domain Number 2 Region: 223-358
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.62e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000008921   Gene: ENSNLEG00000007307   Transcript: ENSNLET00000009342
Sequence length 359
Comment pep:known_by_projection supercontig:Nleu1.0:GL397269.1:46808009:46814813:-1 gene:ENSNLEG00000007307 transcript:ENSNLET00000009342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPLEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
Download sequence
Identical sequences G1R6U9
ENSNLEP00000008921 XP_003257290.1.23891 ENSNLEP00000008921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]