SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009024 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009024
Domain Number 1 Region: 214-278
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.1e-16
Family B-box zinc-binding domain 0.0000318
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009024
Domain Number - Region: 88-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0905
Family Transferrin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009024   Gene: ENSNLEG00000007400   Transcript: ENSNLET00000009450
Sequence length 588
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:53705195:53731935:-1 gene:ENSNLEG00000007400 transcript:ENSNLET00000009450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAADASRSNGSSPEARDARSPSGPNGSLENGTKADGKDAKTTNGHSGEAAEGKSLGSSL
KPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIVDALDERAKVLHED
KQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYMNNYTNSFGGEWSAPDTMKRYSMYLTPKGG
ARTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQSSDNDLPVVQGSSSFS
LKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
Download sequence
Identical sequences G1R752
XP_003253330.1.23891 ENSNLEP00000009024 ENSNLEP00000009024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]