SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009033 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009033
Domain Number 1 Region: 665-916
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-45
Family YWTD domain 0.00000788
Further Details:      
 
Domain Number 2 Region: 257-539
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.15e-31
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 
Domain Number 3 Region: 1464-1649
Classification Level Classification E-value
Superfamily Fibronectin type III 4.48e-29
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 2-187
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.16e-17
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0081
Further Details:      
 
Domain Number 5 Region: 1839-2012
Classification Level Classification E-value
Superfamily Fibronectin type III 2.48e-17
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 6 Region: 1321-1359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 7 Region: 1100-1138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 8 Region: 1228-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1057-1098
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 10 Region: 1275-1308
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 11 Region: 980-1018
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 1143-1176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 13 Region: 1375-1412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000126
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1415-1454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 1021-1060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000111
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 1654-1787
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000288
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 17 Region: 1180-1215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009033   Gene: ENSNLEG00000007411   Transcript: ENSNLET00000009461
Sequence length 2119
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:55047572:55212999:1 gene:ENSNLEG00000007411 transcript:ENSNLET00000009461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSLNDSHNQMVVHWAGEKSNVIVALARDSALARPKSSDVYVSYDYGRSFKKISEKLNFG
AGNKSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKA
SNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYS
TVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSQQQSSVQLWVSFGRKPM
QAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPG
GAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQA
PAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLA
SKTNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFI
FSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSP
SDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLS
LEVCVPDLEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLA
EENEFILYAVRKSIYRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDIIQRL
CLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVL
DRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGSAAYRLVSEDVKWPNGISVDDQWIYW
TDAYLDCIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQVE
ILANQLTGLMDMKIFYKGKNTGSNACVSRPCSLLCLPKANNSRSCRCPEGVSSSVLPSGD
LMCDCPQGYQLKNNTCVKEENTCLRNQYHCSNGNCINSIWWCDFDNDCGDMSDERNCPTT
ICDLDTQFRCHESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSW
VCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNC
EKKCNGFRCPNGTCIPSSKHCDGLRDCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMV
CDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSD
EANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPG
PSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPSLANVTAASTPTQLGRCDRFE
FECHQPKKCIPNWKRCDGHRDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCD
GFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVI
GESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPR
NLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLV
NTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKV
NGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEH
VVTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPRSLTTSLHNK
TVLVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESP
YDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDS
SIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLG
NTTDNFFKISNLKMGHNYTFTVQARCLFGSQICGEPAILLYDELGSGADASAMQAARSTD
VAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGED
DEDAPMITGFSDDVPMVIA
Download sequence
Identical sequences ENSNLEP00000009033 ENSNLEP00000009033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]