SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009116 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009116
Domain Number 1 Region: 593-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.95e-91
Family Eukaryotic proteases 0.0000000045
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-29
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 3 Region: 227-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-19
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 87-170
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000536
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 525-559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 488-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 564-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000168
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009116   Gene: ENSNLEG00000007490   Transcript: ENSNLET00000009552
Sequence length 855
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:63770106:63821794:1 gene:ENSNLEG00000007490 transcript:ENSNLET00000009552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRARKGGGGPKDFGAGLKYSSRHEKVNGLEEGVEFLPVNNVKKVEKRGLGRWVVLAA
GLIGLLFVSLGIGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKV
KDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVM
LPPRARSLKSFVVTSVVAFPTDPKTVQRTQDNSCSFALHTRGVELMRFTTPGFPDSPYPA
HARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVMVYNTLSPMEPHALVQLCGTYPPS
YNLTFHSSQNVLLVTLITNTERRHPGFEATFFQLPKMSSCGGRLRKAQGTFNSPYYPGHY
PPNVDCTWDIEVPNNQHVKVRFKFFYLLEPDVPTGTCPKDYVEINGEKYCGERSQFVVTS
NSNKITVRFHSDQSYTDTGFLAEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDH
SDELNCSCDATYQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFKCSSGKCLSK
SQQCDGKDDCGDGSDEASCAKANVVTCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEK
DCDCGLRSFTRQARVVGGVDADEGEWPWQVSLHALGQGHVCGASLISPSWLVSAAHCYID
DRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPSFNDFTFDYDIALLELEKP
VEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLL
PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT
RLPLFRDWIKEKTGV
Download sequence
Identical sequences G1R7E4
ENSNLEP00000009116 XP_003253455.1.23891 ENSNLEP00000009116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]