SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009500 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009500
Domain Number 1 Region: 30-547
Classification Level Classification E-value
Superfamily ALDH-like 6.02e-123
Family ALDH-like 0.000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009500   Gene: ENSNLEG00000007791   Transcript: ENSNLET00000009955
Sequence length 563
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:7706:42789:-1 gene:ENSNLEG00000007791 transcript:ENSNLET00000009955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAPALRRAVLSRRWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGR
TEAIPCVVGDEEVWTSEVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKP
IADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVEL
EGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRVLREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFRTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSL
WPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLTVYVYADDKYKETLQLVDSTTSYGLTG
AVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILR
WTSPQVIKETHKPLGDWSYAYMQ
Download sequence
Identical sequences A0A2I3FUQ8
ENSNLEP00000009500 XP_003271582.1.23891 XP_012353949.1.23891 ENSNLEP00000009500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]