SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009549 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009549
Domain Number 1 Region: 364-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number 2 Region: 93-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number 3 Region: 451-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 4 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 5 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.035
Further Details:      
 
Domain Number 6 Region: 412-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009549
Domain Number - Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000131
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number - Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000212
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number - Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 59-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009549   Gene: ENSNLEG00000007846   Transcript: ENSNLET00000010007
Sequence length 494
Comment pep:known_by_projection supercontig:Nleu1.0:GL397328.1:2027246:2304980:1 gene:ENSNLEG00000007846 transcript:ENSNLET00000010007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGA
ALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQG
WYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCEC
DDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICS
NRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
CKAGWYGKKCEHPQSCTLSAEESIKKCQGNSDLPCSGRGKCECGKCTCYPPGDRRVYGKT
CECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADG
TLCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGW
NGNACEIWLGSEYP
Download sequence
Identical sequences G1R8L2
ENSNLEP00000009549 XP_003270202.1.23891 XP_012362429.1.23891 ENSNLEP00000009549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]