SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009593 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009593
Domain Number 1 Region: 32-157
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 7.75e-23
Family Extradiol dioxygenases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009593   Gene: ENSNLEG00000007868   Transcript: ENSNLET00000010051
Sequence length 160
Comment pep:known_by_projection supercontig:Nleu1.0:GL397404.1:286966:296207:1 gene:ENSNLEG00000007868 transcript:ENSNLET00000010051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRHLPSRLPVKMWSRTSEKQSWRDGSQTPPPCLIRRLDHIVMTVKSIKDTTMFYSKILG
MEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKA
CDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYISS
Download sequence
Identical sequences G1R8Q6
ENSNLEP00000009593 XP_003276876.1.23891 ENSNLEP00000009593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]