SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009683 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009683
Domain Number 1 Region: 65-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000026
Family EGF-type module 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009683   Gene: ENSNLEG00000007937   Transcript: ENSNLET00000010145
Sequence length 169
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:6031693:6051218:1 gene:ENSNLEG00000007937 transcript:ENSNLET00000010145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGRRMEMLCASRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYMA
LTVILIILFLIIVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
Download sequence
Identical sequences G1R8Z6
ENSNLEP00000009683 XP_003265794.1.23891 ENSNLEP00000009683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]