SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009692 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009692
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000544
Family EGF-type module 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009692   Gene: ENSNLEG00000007948   Transcript: ENSNLET00000010157
Sequence length 178
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:6420697:6476128:-1 gene:ENSNLEG00000007948 transcript:ENSNLET00000010157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAARGSGASSPPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKHRKRKKKEEEMETLGKDITPINEDIEETNIA
Download sequence
Identical sequences G1R905
XP_003265796.1.23891 XP_012354832.1.23891 ENSNLEP00000009692 ENSNLEP00000009692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]