SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009777 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009777
Domain Number 1 Region: 61-279,325-415
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000366
Family Quinoprotein alcohol dehydrogenase-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009777   Gene: ENSNLEG00000008004   Transcript: ENSNLET00000010248
Sequence length 552
Comment pep:novel supercontig:Nleu1.0:GL397322.1:212634:232449:1 gene:ENSNLEG00000008004 transcript:ENSNLET00000010248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDHKDLEAEIHPLKNEERKSQENLGNPSKNEDNVKSAPPQSRLSRCRAAAFFLSLFLCL
FVVFVVSFVIPCPDRPASQRMWRVDYSAAVIYDFLAMDDINGDRIQDVLFLYKNTNSSNN
FSRSCVDEGFSSPCTFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVG
RPGSFIAVDVFTGETLWNHSSSFSRNASVLSPLLQVPDVDGDGAPDLLVLTQEQEEVSGH
LYSSSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSG
GPFKSDPHWESMLNATTRRVLSHSSGAVRYLMHVPGNAGADVLLVGSEAFVLLDGQELTP
RWTPKAAHVLRKPIFGHYKPDTLAVVVENGTGTDRQILFLDLGTGAVLCSLALPSLPGGP
LSASLPTADHRSAFFFWGLHELGSTSETESGEARHSLYMFHPTLPRVLLELANVSTHIVA
FDAVLFEPSRHAAYVLLTGPADSEAPGLVSVIKHKVRDLVPSSRVVRLGEGGPDSDQAIR
DRFSRLRYRSEA
Download sequence
Identical sequences G1R988
ENSNLEP00000009777 ENSNLEP00000009777 XP_003269151.1.23891 XP_012352691.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]