SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009821 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009821
Domain Number 1 Region: 18-170,342-359,408-593
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.02e-29
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 2 Region: 1326-1448
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000497
Family WD40-repeat 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009821
Domain Number - Region: 966-1201,1268-1304
Classification Level Classification E-value
Superfamily ARM repeat 0.000144
Family GUN4-associated domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009821   Gene: ENSNLEG00000008020   Transcript: ENSNLET00000010294
Sequence length 1457
Comment pep:known_by_projection supercontig:Nleu1.0:GL397295.1:2201915:2547857:1 gene:ENSNLEG00000008020 transcript:ENSNLET00000010294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNSLVLPIVLWGRKAPTHCISAVLLTDDGATIITGCHDGQICLWDLSVELEINPRALL
FGHTASITCLSKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTGIQFYQFS
VGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAL
SVTGILKVWIVTSEISDMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRV
FDAGDYSLLCSGPSENGQTWTGGDFISADKVIIWTENGQSYIYKLPASCLPASDSFRSDV
GKAVENLIPPVQHSLLDRKDKELLICPPVTRFFYGCREYFHKLLIQGDSSGRLNIWNISD
TADKQESEEGLAMTTSVSLQEAFDKLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGR
LVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARY
DQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHCICSVASDH
SVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMG
ITAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRRSLAALKNMAHHKLQTLATNLLASEA
SDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALIIQLLTEEASRPNTALISPENL
QKASGSSDKGSSFLTGKRAAVLFQQVKETIKENIKEHLLDDEEEDEEIMRQRREESDPEY
RSSKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSR
GGHMSLMLPGYNQPACKLSHGKTEVGRKLPATEGVGKGTYGVSRAVTTQHLLSIISLANT
LMSMTNATFIGDHMKKGPTRPPRPSTPDLSKARGSPPTSSNIVQGQIKQGWSQLAAMHCV
MLPDLLGLDKFRPPLLEMLARRWQDRCLEVREAAQALLLAELRRIEQAGRKEAIDAWAPY
LPQYIDHVISPGVTSEAMQTITTAPDASGPEAKVQEEEHDLVDDDITTGCLSSVPQMKKI
STSYEERRKQATAIVLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLAR
HTCKALTFLLLQPPSPKLPPHSTIRRTAIDLIGRGFTVWEPYMDVSAVLMGLLELCADAE
KQLANITMGLPLSPAADSARSARHALSLIATARPPAFITTIAKEVHRHTALAANTQSQQN
MHTTTLARAKGEILRVIEILIEKMPTDVVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAI
CRFYMVSYYERNHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYS
NTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQPASPGSHNALKLARLIWTSN
RNVILMAHDGKEHRFMV
Download sequence
Identical sequences G1R9D1
ENSNLEP00000009821 XP_003264316.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]