SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009841 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000009841
Domain Number - Region: 457-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009841   Gene: ENSNLEG00000008064   Transcript: ENSNLET00000010315
Sequence length 731
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:345124:352062:-1 gene:ENSNLEG00000008064 transcript:ENSNLET00000010315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEVGLVSEHFSQAPQRLSFYSWYGSARLFRFRVPPDTVLLRWLLQVSRESSAACTDAEIT
VHFRSGAPPVINPLGTSFPDDTTVQPSFQVRVPLSAAPLSNASINVSHPAPGDWFVAAHL
PPSSQKMELKGLAPTCAYVFQPELLVTRVVKISIMEPDVPLPQTLLSHPSYLKVFVPDYT
RELLLELRDCVSNRSLGCPVRLTVGPVTLPSNFQKVFTCTGAPWPCRLLLPSPPWDRWLQ
VTAESLVGPLGTVAFSAVAALTACRPRSVTVQPLLQRSQKESFASSGLLSPSPDHHDLGR
NGRVDLSPFCLTSYPVLREDMDVLSVHFQPDRVSGEGVCRTHPSVMWLKAPTPAGRGGSC
LRHCLPFQTEMRNETVIVACVNAASPFLGFNISLNCTTAFFQGYPLSLSASSHRANLIIP
YPETDNWYLSLQLMCPENAEDCEQAVVHVETTLYLVPCLNDCGPYGQCLLLRRHSYLYAS
CSCKAGWRGWSCTDNSTAQTVAQQRAAALLLTLSNLMFLAPIAVSVQRFFLVEASVYAYT
MFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGAAIWVTILCMARLKTVLKYVLFLLG
TLVIAMSLQLDRRGIWNMLGPCLFAFVIMASMWAYRCGHRRQCYPTSWQRWAFYLLPGVS
MASVGIAIYTSMMTSDNYYYTHSIWHVLLAGSAALLLPPPDQHAEPWACSQKFPCHYQIC
KNDREELYTVT
Download sequence
Identical sequences ENSNLEP00000009841 ENSNLEP00000009841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]