SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010173 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010173
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000138
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 107-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010173   Gene: ENSNLEG00000008358   Transcript: ENSNLET00000010673
Sequence length 223
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:358689:361510:1 gene:ENSNLEG00000008358 transcript:ENSNLET00000010673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSQEVLLTWLLVLAVGGTEHTYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPHYACCPGWKRTSGFPGACGAAICQPPCRNGGSCVQP
GRCRCPAGWQGETCQSDVDECSARRDSCPQGCVNTAGSYWCQCWEGHSLSADGTLCVPKG
GPPRVAPNPTGVDTAMKEEVQRLQSRVDLLEEVRRGVGQVITT
Download sequence
Identical sequences ENSNLEP00000010173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]