SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010344 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010344
Domain Number 1 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000271
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 2 Region: 817-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 3 Region: 970-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family Laminin-type module 0.0031
Further Details:      
 
Domain Number 4 Region: 265-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000963
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 5 Region: 863-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 6 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 455-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 413-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 1080-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 10 Region: 923-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.066
Further Details:      
 
Domain Number 11 Region: 769-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 12 Region: 1128-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 13 Region: 1034-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family Laminin-type module 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010344
Domain Number - Region: 1566-1758
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 104-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.074
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010344   Gene: ENSNLEG00000008405   Transcript: ENSNLET00000010851
Sequence length 1761
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:1596289:1700281:1 gene:ENSNLEG00000008405 transcript:ENSNLET00000010851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNTQLTASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYAQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHTWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFEIENLYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKVWGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCE
DCQHNTEGQHCDHCRPVFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPTLGSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSY
VTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGRSCSEPV
PGYFFAPLNFYLYEAEEATPLQGLAPLGLGTFGQSPAVHVVLGEPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIRYETQSAADWTAQIMVNAPGGSEHCVPKTPWSKPQS
FALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLEGESHAHSHILVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKPLVVGRCCDRCSTGSYDLGHHGCHPCRCHPQGSKDTVCDQVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCRPCPCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPNDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGAQCGECSTGFYGNP
RISGAPCRPCACNNNIDVTDPESCSRVTGECLRCLHNTQGTNCQLCKPGHYGSALNQTCR
RCSCHASGVSPTECPPGGGACLCDPVTGACPCLPNVTGLSCDRCADGYWNLVPGRGCQSC
DCDPRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPPGRCIPCDCNRAGTQKPIC
DPDTGMCRCREGVSGQRCDRCAPGHSQEFPTCLQCHLCFDQWDHIISSLSKAVQGLMRLA
ANIEDKRETLPVYEADFKGLRGNVSEIERILKHPVFPSGKFLKVKDYQDSVRKQIMQLNE
QLKAVYEFQDLKDTIERAKNEADLLLEDLQEEIDLQSSVLNASIVDSSENIKKYYHISSS
AEKKINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPG
NVPCVPLPCGGALCTGRKGHRKCGGPGCHSSLTLSTNALQKAQEAKSVIHNLDKQVRGLK
NQIKNISKLAEVSKNNALQLREKLGNIRNQSDSEEEKINLFIKKVKNFLLEENMPPEDIE
KVANGVLDIHLPIPSQNLTDELDKIQKLRQLCEDYRTDENRLNEEADGAQKLLVKAKAAE
KAANVLLNLDKTLNQLQQAQITQGRADSTITQLTANITKIKKNVLQAENQTREMKSALAL
AKQRSGLEDGLSLLQTKLQRHQDQAVNAKVQAESAQHQAGSLEKEFVELKKQYAILQRKT
STTGLTKETLGKVKQLKDAAERLAGDTEDKIRRITDLERKIQDLNLSRQAKADQLRILED
QVVAIKNEIVVQEKKYATCYS
Download sequence
Identical sequences ENSNLEP00000010344 XP_003268179.1.23891 ENSNLEP00000010344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]