SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010457 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010457
Domain Number 1 Region: 979-1031
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 2 Region: 885-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 933-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 447-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 5 Region: 383-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000774
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 6 Region: 1088-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 7 Region: 1040-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.067
Further Details:      
 
Domain Number 8 Region: 570-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 9 Region: 622-662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 10 Region: 1196-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 527-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 12 Region: 1140-1193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 13 Region: 1244-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1650-1774
Classification Level Classification E-value
Superfamily Prefoldin 0.0000445
Family Prefoldin 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010457
Domain Number - Region: 1322-1469
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0785
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010457   Gene: ENSNLEG00000008501   Transcript: ENSNLET00000010969
Sequence length 1898
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:1720499:1800222:1 gene:ENSNLEG00000008501 transcript:ENSNLET00000010969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTGKCPSPAALADMVSNKRGAPGGGTGTSPGPRRVAAARPFSPGSLYAHDQRRLPSVPPK
AKLSNSLLWARGLQEPGERSRRRKGRREERAGGSAGVFSNPMPLPGGCREPAWGFLQVFA
FSFLALCGARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVS
HLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLE
AEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDI
ICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLL
DSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFKEEVEGMVHGHCMCRHNTKGLN
CELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYMATGNISGGVCDDCQHN
TMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRC
RLNVEGEHCDVCKEGFYDLSGEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQ
HCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYY
FATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSM
EYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPR
PVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTN
SAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPN
GGQCQCRPNVIGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQCHCFQGVYA
RQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPII
GSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSE
VGGSCQPCQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALRQDCRKC
VCNYLGTVQEHCNGSDCQCDKATGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNA
AHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQST
GQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALK
ISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVE
VKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMS
LEAEERVNASTTEPNSTVEQSALMRDRVEDVMMEQESQFKEKQEEQARLLDELAGKLQSL
DLSAAAEMTCGTPPGASCSETECGGPNCRTDEGEKKCGGPGCGGLVTVAHNAWQKAMDLD
QDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIR
NFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQQSAADI
ARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLT
SIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKR
TLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYE
DNQKYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
Download sequence
Identical sequences ENSNLEP00000010457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]