SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010782 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000010782
Domain Number - Region: 512-592
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0419
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010782   Gene: ENSNLEG00000008826   Transcript: ENSNLET00000011308
Sequence length 946
Comment pep:known_by_projection supercontig:Nleu1.0:GL397336.1:676278:1055617:-1 gene:ENSNLEG00000008826 transcript:ENSNLET00000011308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPAPAPRRERRDLPAE
PAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARALDPHPSPLITLET
QVSTFPVLATYXXXXXXXXXXXVPKDFENVDNSNFAPRTQKQKRQPELAKKAPSRQKELL
KRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRLPHARKTGGSSPETKYDQ
PPECDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQW
DEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQ
VSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTND
QLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGS
DWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRIT
NWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLD
YYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAEMSLHTDGEN
SCRYYPMGQPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPPSD
FGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPVNVIAA
TYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQPIKLE
EALKLHNGPLRNAYMEQSFQSLNPVLSLPISPAQVEQARRNAASTGTALEGWLDSLVGGM
WTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences ENSNLEP00000010782 ENSNLEP00000010782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]