SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010796 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010796
Domain Number 1 Region: 195-492
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.89e-42
Family NadC C-terminal domain-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010796
Domain Number - Region: 94-126
Classification Level Classification E-value
Superfamily DUSP-like 0.0968
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010796   Gene: ENSNLEG00000008842   Transcript: ENSNLET00000011323
Sequence length 499
Comment pep:novel supercontig:Nleu1.0:GL397314.1:3443575:3479250:1 gene:ENSNLEG00000008842 transcript:ENSNLET00000011323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRGPAVESERGFPRRASPARSPLAGQVTHYKQYPPNTSKVYSYFECREKKTENSKLRKV
KYEETVFYGLQYILNKYLKGKVVTKEKIQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHL
PIEVKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKIL
AKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYG
TKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWG
EDLRHLIVSRSTEAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQ
GDGVDINTLQEIVEGMKQKKWSIENIAFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGIN
VFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYS
FDEIRKNAQLNIELEAAPH
Download sequence
Identical sequences ENSNLEP00000010796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]